PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10028556m
Common NameCICLE_v10028556mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 408aa    MW: 44948.4 Da    PI: 8.3634
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10028556mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.2e-32264319156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Ciclev10028556m 264 KQRRCWSPELHRRFVSALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 319
                      79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.339261321IPR017930Myb domain
SuperFamilySSF466894.98E-18261322IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-29262322IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26264319IPR006447Myb domain, plants
PfamPF002499.7E-8266317IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MGSVPPELSL DFRPTNFVPK TITDFLREVS LIGNVSEKLS KLDSFLKGLE DELRKIDAFK  60
RELPLCMLLL NDAILVLKEE SMQCARASKK VQPVLEEFIP LKNNNSEDDD EDARPIKKEK  120
DSSKDNKKNW MSSVQLWNTD YNHPTNDPIF DSKQNLNLKI KRNEEENPFQ ACKSRAGAVA  180
GAGAGATAFL PFKTCPVFPR KDDKEELPVH GLSLVTPGMK NPREDTGSTG SRTSCSKSVS  240
SSAPNVQSNL RTGPQPPQQQ TNRKQRRCWS PELHRRFVSA LQQLGGSQVA TPKQIRELMQ  300
VDGLTNDEVK SHLQKYRLHT RRTSPAVPAA PANQSTVVLG SLWMSQDQYG DSSKASSSQS  360
GSPQGPLQLT GNTGGTSTTG GDSMEDDEDA KSEGYSWKSH IHKPGKE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006423074.10.0hypothetical protein CICLE_v10028556mg
TrEMBLV4UAM00.0V4UAM0_9R
STRINGVIT_03s0063g01060.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM145351021
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-55G2-like family protein